Bovine Prion Protein analyzed with Online Interactive Tools

Do your own study off-site using dozens of online tools

Results of SAPS statistical study of bovine prion sequence
Results of MSF for recognizing bovine prion sequence repeats
Results of REPRO for recognizing protein sequence repeats
Results of a TagIdent search for proteins of similar size and isoelectric point
Results of 2D PAGE search for similarity
Results of Biocellerator homology search
Results of Signalp for prediction of the signal peptide cleavage sites


The online interactive tool, SAPS (Statistical Analysis of Protein Sequences) evaluates by statistical criteria a wide variety of protein sequence properties. Here's what the program returned when the amino acid sequence of bovine prion protein was run on August 27:

  • Bovine prion protein, 264 bases; molecular weight: 28,600; pIsoelectric=9.39 1 MVKSHIGSWI LVLFVAMWSD VGLCKKRPKP GGGWNTGGSR YPGQGSPGGN RYPPQGGGGW 61 GQPHGGGWGQ PHGGGWGQPH GGGWGQPHGG GWGQPHGGGG WGQGGTHGQW NKPSKPKTNM 121 KHVAGAAAAG AVVGGLGGYM LGSAMSRPLI HFGSDYEDRY YRENMHRYPN QVYYRPVDQY 181 SNQNNFVHDC VNITVKEHTV TTTTKGENFT ETDIKMMERV VEQMCITQYQ RESQAYYQRG 241 ASVILFSSPP VILLISFLIF LIVG
  • Compositional Analysis, relative to a large dadabase of proteins, showed anomylous quantiles:
    glycine-- 99%,tryptophan -- 95%, lysine and glutamate --5%
    A 10( 3.8%)C3( 1.1%)D-6( 2.3%)E8( 3.0%)F7( 2.7%)
    G++51(19.3%) H+12( 4.5%)I11( 4.2%)K11( 4.2%)L-11( 4.2%)
    M9(3.4%)N11(4.2%)P18(6.8%)Q17(6.4%)R11(4.2%)
    S15(5.7%)T12(4.5%)V18(6.8%)W+10(3.8%)Y13(4.9%)

  • Charge and codon analysis of bovine prion protein:
    + charge22(8.3%)- charge14(5.3%)total charge36(13.6%)net + charge8(3.0%)
    FIKMNY62(23.5%)AGP+79(29.9%)ser-thr27(10.2%)hydrophobics56(21.2%)
    AGP: encoded by CCN, GCN, and GGN codons ... FIKMNY: encoded by AAN, AUN, UAN, and UUN codons
  • Charge distribution analysis:
    Note SAPS fails to detect the pronounced positive and negative faces detected by NMR
     1  00+0000000 000000000- 0000+++0+0 000000000+ 0000000000 +000000000 
          61  0000000000 0000000000 0000000000 0000000000 0000000000 0+00+0+000 
         121  +000000000 0000000000 000000+000 0000-0--+0 0+-000+000 0000+00-00 
         181  00000000-0 00000+-000 0000+0-000 -0-0+00-+0 0-00000000 +-000000+0 
         241  0000000000 0000000000 0000
    Positive charge clusters (cmin =  8/30 or 11/45 or 13/60):  none
    Negative charge clusters (cmin =  6/30 or  8/45 or 10/60):  none
    Mixed charge clusters (cmin = 11/30 or 15/45 or 18/60):  none
    
    High scoring positive charge segments: none
    High scoring negative charge segments: none
    High scoring mixed charge segments:  none
    
    
  • Run count statistics: + runs >= 3: 1, at 25 - runs >= 3: 0 * runs >= 3: 2, at 25; 157 0 runs >= 37: 1, at 52
  • High scoring hydrophobic segments: 1) From 123 to 142: length= 20, score=26.00 ** 123 VAGAAAAGAV VGGLGGYMLG L: 2(10.0%); A: 6(30.0%); G: 7(35.0%); V: 3(15.0%); 2) From 251 to 264: length= 14, score=21.00 * 251 VILLISFLIF LIVG L: 4(28.6%); V: 2(14.3%); I: 4(28.6%); F: 2(14.3%)
  • High scoring transmembrane segments: 1) From 123 to 145: length= 23, score=54.00 ** 123 VAGAAAAGAV VGGLGGYMLG SAM A: 7(30.4%); G: 7(30.4%); V: 3(13.0%); 2) From 240 to 264: length= 25, score=66.00 ** 240 GASVILFSSP PVILLISFLI FLIVG L: 5(20.0%); S: 4(16.0%); V: 3(12.0%); I: 5(20.0%); F: 3(12.0%)
  • Spacing of Cysteines. NH2-23-C-165-C-34-C-39-COOH

  • Repeats:
    Aligned matching blocks:
    
    [  56-  70]   GGGGWGQPHGGGWGQ
    [  97- 109]   GGGGWGQ__GGTHGQ
    
    Simple tandem repeat: 
    
    [  57-  64]    _GGGWGQPH
    [  65-  72]    _GGGWGQPH
    [  73-  80]    _GGGWGQPH
    [  81-  88]    _GGGWGQPH
    [  89-  96]    _GGGWGQPH
    [  97- 103]    GGGGWGQ__
    [ 104- 105]    GG
  • Repeats: using reduced 11-letter alphabet
    (that lumps major hydrophobics LVIF, charged residues KR and ED, small residues AG, hydroxyl group residues ST, amide group residues NQ, and aromatics YW. )

    Nothing significant found.

  • Homo-oligopeptides of any length:
    1. Total number of amino acid multiplets:  26  (Expected range:   5-- 30)
    
    2. Histogram of spacings between consecutive amino acid multiplets:
       (1-5) 11   (6-10) 8   (11-20) 5   (>=21) 3
    
    3. Clusters of amino acid multiplets:  none
    
    4. Significant specific amino acid altplets (e.g., RG, EAEAEA, etc.):
    AA ........ Observed (Critical number)
    Leu-Ile 7 (5) position: 10, 149, 244, 252, 254, 258, 261
  • Charge multiplets:
    Nothing significant was found:
    1. Total number of charge multiplets: 2 (Expected range: 0-- 7) 1 +plets (f+: 8.3%), 1 -plets (f-: 5.3%) Total number of charge altplets: 5 (Critical number: 9) 2. Histogram of spacings between consecutive charge multiplets: (1-5) 0 (6-10) 0 (11-20) 0 (>=21) 3
  • Periodic elements:
    AMINO ACID ALPHABET 
    
    Location	Period	Element		
      31- 102	 6	G.G...    	10	 4  	
      60-  99	 8	WGQPHGGG  	 5	 5 !
      90- 110	 3	G..       	 6	 4  	
     130- 145	 4	G...      	 4	 4  	
    
    HYDROPHOBICITY ALPHABET {*= KRED; i= LVIF; 0}
    
    Location .... 	Period	 ..... Element		
     251- 263	 1	LVIF-type         	12	 7 !	 1
  • Spacing analysis: The spacings between consecutive residues of the same type (all 20 amino acids, + and - charge, and combined charge *) are evaluated for signifi- cantly large or small maximal and minimal spacings. The output is ordered by the beginning point of the significant spacing. Entries are identified by the residue type, spacing (number of amino acids between the identified positions), rank of the displayed spacing (e.g., 50 alanines in the sequence induce 51 spacings, ranked by decreasing length from 1 to 51), and p-value (probability of exceeding the displayed spacing).. If the first maximal spacing (rank 1) of a residue is significantly large or small, then also the second maximal spacing (rank 2) is evaluated. Large maximal and small minimal spacings indicate clustering effects, whereas small max- imal and large minimal spacings indicate excessive evenness in the distri- bution of the residues.
    Location (Quartile) Spacing     Rank       P-value   Interpretation
    
       0- 157  (2.)     E( 157)E     1 of   9   0.0056   large  1. maximal spacing
      10- 150  (2.)     I( 140)I     1 of  12   0.0023   large maximal spacing
      20- 155  (2.)     -( 135)-     1 of  15   0.0005   large maximal spacing
      21- 123  (2.)     V( 102)V     1 of  19   0.0020   large maximal spacing
      34-  60  (1.)     W(  26)W     2 of  11   0.9959   small  2. maximal spacing
      51- 112  (2.)     *(  61)*     1 of  37   0.0013   large maximal spacing
     110- 265  (3.)     W( 155)W     1 of  11   0.0012   large  1. maximal spacing
     153- 206  (3.)     G(  53)G     1 of  52   0.0001   large  1. maximal spacing
     163- 197  (3.)     E(  34)E     2 of   9   0.9694   small  2. maximal spacing
     206- 240  (4.)     G(  34)G     2 of  52   0.0000   large  2. maximal spacing

  • Multiple alignment of repeat sets:
    64_73           GGTNWG..QP .....HP... .........
    74_83           GGSNWG..QP .....HP... .........
    84_92           GGSSWG..QP .....H.... .........
    93_100         GGSNWG..QG .......... .........
    101_129       GYNKWKPDKP KTNLKHVAGA AAAGAVVGG
    
    57_66           GWGH...... .P........ QGGGT..... ....
    67_76           NWGQ...... .P........ HPGGS..... ....
    77_86           NWGQ...... .P........ HPGGS..... ....
    87_95           SWGQ...... .P........ HGGS...... ....
    96_129         NWGQGGYNKW KPDKPKTNLK HVAGAAAAGA VVGG
    
    56_75           PGWGHPQGGG TNWG..QP.. ...HPGG... .......
    76_94           SNWGQPHPGG SSWG..QP.. ...HGG.... .......
    95_129         SNWGQ..GGY NKWKPDKPKT NLKHVAGAAA AGAVVGG
    
    4_16            IQLGYWILVL FIV
    245_257     VTLLFLSFLI FLI
    
    18_47           WSDLGLCKKP KPRPGGG..W NSGGSNRY.P GQP
    78_110         WGQPHPGGSS WGQPHGGSNW GQGGYNKWKP DKP
    
    29_70           PRPGGGWNSG GSNRYPGQPG SPGGNRYPGW GHPQGGGTNW GQ
    71_99           PHPG...... GSN..WGQP. HPGGS...SW GQPHGG.SNW GQ
    
    37_45           SGGSNRYPG
    49_57           SPGGNRYPG 
    42_57           RYPGQPGSPG GNRYPG
    161_176       RYPNQVMYRP IDQYSS
    
    139_149       MSRPVIHFGN E
    167_177        MYRPIDQYSS Q 
    
    143_167        VIHFGNEYED ...RYYRENQ YRYPNQVM
    220_247        ITQYQAEYEA AAQRAYNMAF FSAPPVTL

    This REPRO output is a result of a sequence self comparison. Just the subsequences with highest similarity scores (top non-overlapping pairwise alignments) are listed (numbered sequentially under 'repeat' followed by residue length, score and score per residue). This is followed by a list of repeat sets deduced from the top alignments (called 'repeat set').

    The sets are ordered on the numbers of repeating fragments they obtain. Finally, for each set the repeat segments are multiply aligned. The repeat fragments in different sets can be similar but reflect different sequence site ranges (i.e. the repeats are shifted with one to a few residues).


    repeat 1 length = 20 score = 89.00 mean score = 4.45 56 PGWGHPQGGG TNWGQPHPGG 75 || | || ||||| | 76 SNWGQPHPGG SSWGQPHGGS 95
    - repeat 2 length = 43 score = 82.00 mean score = 1.91 29 PRPGGG-WNS GGSNRYPGQP GSPGGNRYPG WGHPQGGGTN WGQ 70 | ||| | ||| ||| || | || | ||| 71 PHPGGSNW-- -------GQP -HPGG---SS WGQPH-GGSN WGQ 99
    - repeat 3 length = 10 score = 58.00 mean score = 5.80 67 NWGQPHPGGS 76 |||||||||| 77 NWGQPHPGGS 86
    - repeat 4 length = 33 score = 47.00 mean score = 1.42 18 WSD--LGLCK KPKPRPGGGW NSGGSNRY-P GQP 47 | | | | | || | | | 78 WGQPHPGGSS WGQPHGGSNW GQGGYNKWKP DKP 110
    - repeat 5 length = 10 score = 45.00 mean score = 4.50 77 NWGQPHPGGS 86 ||||| | 87 SWGQPHGGSN 96
    - repeat 6 length = 18 score = 42.00 mean score = 2.33 74 GGSNWGQPHP GGSSWGQP 91 ||||||| | | 93 GGSNWGQ--G GYNKWKPD 108
    - repeat 7 length = 39 score = 39.00 mean score = 1.00 56 PGWGHPQGGG TNWGQPHPGG SNWGQPHPGG SSWGQPHGG 94 || ||| | | | | || 95 SNWG--QGGY NKWKPDKPKT NL--KHVAGA AAAGAVVGG 129
    - repeat 8 length = 8 score = 38.00 mean score = 4.75 84 GGSSWGQP 91 ||| ||| 93 GGSNWGQG 100
    - repeat 9 length = 28 score = 37.00 mean score = 1.32 143 VIHFGNEYE- --DRYYRENQ YRYPNQVM 167 ||| | | | 220 ITQYQAEYEA AAQRAYNMAF FSAPPVTL 247
    - repeat 10 length = 9 score = 36.00 mean score = 4.00 37 SGGSNRYPG 45 | | ||||| 49 SPGGNRYPG 57
    - repeat 11 length = 11 score = 31.00 mean score = 2.82 139 MSRPVIHFGN E 149 | || 167 MYRPIDQYSS Q 177
    - repeat 12 length = 16 score = 30.00 mean score = 1.88 42 RYPGQPGSPG GNRYPG 57 ||| | | 161 RYPNQVMYRP IDQYSS 176
    - repeat 13 length = 13 score = 30.00 mean score = 2.31 4 IQLGYWILVL FIV 16 | | 245 VTLLFLSFLI FLI 257

    -
  • Sequence fragments derived from graph clustering: repeat set: 5 fragments 64_73 GGTNWGQPHP* 74_83 GGSNWGQPHP* 84_92 GGSSWGQPH* 93_100 GGSNWGQG* 101_129 GYNKWKPDKPKTNLKHVAGAAAAGAVVGG*
    - repeat set: 5 fragments 57_66 GWGHPQGGGT* 67_76 NWGQPHPGGS* 77_86 NWGQPHPGGS* 87_95 SWGQPHGGS* 96_129 NWGQGGYNKWKPDKPKTNLKHVAGAAAAGAVVGG*
    - repeat set: 3 fragments 56_75 PGWGHPQGGGTNWGQPHPGG* 76_94 SNWGQPHPGGSSWGQPHGG* 95_129 SNWGQGGYNKWKPDKPKTNLKHVAGAAAAGAVVGG*
    - repeat set: 2 fragments 4_16 IQLGYWILVLFIV* 245_257 VTLLFLSFLIFLI*
    - repeat set: 2 fragments 18_47 WSDLGLCKKPKPRPGGGWNSGGSNRYPGQP* 78_110 WGQPHPGGSSWGQPHGGSNWGQGGYNKWKPDKP*
    - repeat set: 2 fragments 29_70 PRPGGGWNSGGSNRYPGQPGSPGGNRYPGWGHPQGGGTNWGQ* 71_99 PHPGGSNWGQPHPGGSSWGQPHGGSNWGQ*
    - repeat set: 2 fragments 37_45 SGGSNRYPG* 49_57 SPGGNRYPG*
    - repeat set: 2 fragments 42_57 RYPGQPGSPGGNRYPG* 161_176 RYPNQVMYRPIDQYSS*
    - repeat set: 2 fragments 139_149 MSRPVIHFGNE* 167_177 MYRPIDQYSSQ*
    - repeat set: 2 fragments 143_167 VIHFGNEYEDRYYRENQYRYPNQVM* 220_247 ITQYQAEYEAAAQRAYNMAFFSAPPVTL*
    -
  • Here are the results of the TagIdent Search. This looks for proteins close to bovine prion in molecular weight and isoelecric point. It is a way of finding homlogous or similar proteins. The first 40 amino acids are also provided.

    Search performed with following values:
            pI =            9.4
            Mw =            25000
            delta-pI =      0.3
            delta-Mw =      5000
            OS or OC =      MAMMALIA
    ---------------------
    154 proteins found (only a few are retained here)
            ABME_RABIT      (P47855)
                    [pI = 9.17; Mw = 27719.0]
                    MASEK GPSNK DYTLR RRIEP WEFEV FFDPQ ELRKE ACLLY
    
            ACRO_PIG        (P08001)
                    [pI = 9.66; Mw = 43837.24]
                    [pI = 8.95; Mw = 2611]
                    [pI = 9.35; Mw = 2790]
                    MLPTAVLLVLAVSVAARDNATCDGPCGLRFRQKLESGMRV
    
            ARL4_HUMAN      (P40617)
                    [pI = 9.26; Mw = 22615.0]
                    MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRL
    
            ARL4_RAT        (P41275)
                    [pI = 9.26; Mw = 22588.0]
                    MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRL
    
            ASH2_RAT        (P19360)
                    [pI = 9.32; Mw = 27694.7]
                    MESHFNWYGVPRLQKASDACPRESCSSALPEAREGANVHF
    
            ATP6_HALGR      (P38591)
                    [pI = 9.30; Mw = 24862.6]
                    MNENLFASFTTPTMMGLPIVILIVLFPSILFPSPDRLINN
    
            ATP6_PHOVI      (Q00521)
                    [pI = 9.69; Mw = 24793.5]
                    MNENLFASFATPTMMGLPIVILIVLFPSILFPSPDRLINN
    
            ATP6_RAT        (P05504)
                    [pI = 9.60; Mw = 25050.1]
                    MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISN
    
            ATPF_BOVIN      (P13619)
                    [pI = 9.14; Mw = 24668.5]
                    PVPPLPEHGGKVRFGLIPEEFFQFLYPKTGVTGPYVLGTG
    
                    MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRT
    
            PRIO_BOVIN      (P10279)
                    [pI = 9.49; Mw = 25939.9]
                    MVKSHIGSWILVLFVAMWSDVGLCKKRPKPGGGWNTGGSR
    
            PRIO_HUMAN      (P04156)
                    [pI = 9.39; Mw = 25235.2]
                    MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPG
    
            PRIO_MACFA      (P40254)
                    [pI = 9.45; Mw = 25250.3]
                    MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPG
    
            PRIO_MESAU      (P04273)
                    [pI = 9.58; Mw = 22973.4]
                    MANLSYWLLALFVAMWTDVGLCKKRPKPGGWNTGGSRYPG
    
            PRIO_MOUSE      (P04925)
                    [pI = 9.56; Mw = 25477.4]
                    MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPG
    
            PRIO_MUSVI      (P40244)
                    [pI = 9.45; Mw = 25074.1]
                    MVKSHIGSWLLVLFVATWSDIGFCKKRPKPGGGWNTGGSR
    
            SPC4_RAT        (P42667)
                    [pI = 9.15; Mw = 20599.1]
                    MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLM
    
           ; Mw = 25791.3]
                    MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAK
    
            VATD_BOVIN      (P39942)
                    [pI = 9.44; Mw = 28333.6]
                    MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDAL
    
            VATE_MOUSE      (P50518)
                    [pI = 9.28; Mw = 26587.8]

    Here are the proteins most likely to be confused with bovine prion on 2D polyacrylamide gel electrophoresis (molecular weight and pI).
      1     8 PRIO_HUMAN   9.39    25235 PRION PROTEIN.
       2    73 C1QA_HUMAN   9.34    23688 COMPLEMENT C1Q SUBCOMPONENT, A CHAIN.
       3   193 HXD4_HUMAN   9.44    27895 HOMEOBOX PROTEIN HOX-D4 (HOX-4B) (HOX-5
       4   230 CAP7_HUMAN   9.53    24051 AZUROCIDIN.
       5   231 MCP1_HUMAN   9.60    25030 CHYMASE.
       6   231 UNG1_HUMAN   9.28    25791 URACIL-DNA GLYCOSYLASE.
       7   257 C24A_HUMAN   9.61    20827 CYTOCHROME B-245 LIGHT CHAIN (P22
       8   278 MYP0_HUMAN   9.57    24763 MYELIN P0 PROTEIN.
       9   286 RS3_HUMAN    9.68    26688 40S RIBOSOMAL PROTEIN S3.
      10   287 BTF3_HUMAN   9.41    22168 BTF3A.
      11   321 OC3B_HUMAN   9.39    30084 OCTAMER-BINDING TRANSCRIPTION FACTOR 3B 
      12   327 HXA5_HUMAN   9.32    29359 HOMEOBOX PROTEIN HOX-A5 (HOX-1C).
      13   343 CD28_HUMAN   9.39    23085 T-CELL-SPECIFIC SURFACE GLYCOPROTEINCD28
      14   344 RU2B_HUMAN   9.72    25486 U2 SMALL NUCLEAR RIBONUCLEOPROTEIN B".
      15   345 TCF1_HUMAN   9.62    30264 T-CELL-SPECIFIC TRANSCRIPTION FACTOR 1 
      16   345 T2FB_HUMAN   9.24    28380 TRANSCRIPTION INITIATION FACTOR IIF,
      17   352 CDX1_HUMAN   9.58    28124 HOMEOBOX PROTEIN CDX-1.
      18   355 G11_HUMAN    9.30    28885 G11 PROTEIN.
      19   356 S5A2_HUMAN   9.47    28393 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE 2 
      20   363 HXC5_HUMAN   9.57    24976 HOMEOBOX PROTEIN HOX-C5 (HOX-3D) (CP11)

    Biocellerator homology searches

    * Maruspial sequence run against databases on theory that it might be more conservative than eutherian prion proteins, hence have more easily recognized homology. The search engines returned lots of prion proteins; below them some high glycine proteins returned at much weaker homology:

    ...
    rat             prion      ......                                               914
    chicken    prion ......                                                    443
    fruit fly    hnRNP  .....                                                 151
    human   fibrinogen alpha-1 chain precursor       137
    ...

    * Run with chicken prion protein on the theory that it might be more closely related to older homologous proteins.

    ...
    rat                     prion         392
    slime mold        annexin     204
    human               annexin     147
    ...
    * Test against fragment of chicken hexapeptide repeat: PSGGGWGAGS HRQPSYPRQP GYPHN PGYPH is interesting because other prions are not near neighbors.
    ...
    slime mold        annexin
    human               coup transcription
    ...

    Proposed but not done yet: Run homology search on prion anti-gene, the large open reading frame of unknown function found on the anti-sense gene in all animals except mink and marsupial, on the theory that a duplicated anti-gene could have had the original function and the prion gene evolved from it later. See:
    Nature 362: 213-4 (1993) "An anti-prion protein?" [letter], Moser M; Oesch B; Bueler H 
    Nature 351: 106 (1991) "Anticipating the anti-prion protein?"[letter], Goldgaber D 
    Gene 159: 181-186 1995 Windl, O et al

    Using neural networks trained on eukaryotic signal peptide data.
    
    prion: first 43 residues of consensus sequence
    
    # pos  aa    C       S       Y
        1   M   0.011   0.919   0.000
        2   V   0.011   0.942   0.000
        3   K   0.011   0.945   0.000
        4   S   0.011   0.945   0.000
        5   H   0.013   0.949   0.000
        6   I   0.010   0.940   0.000
        7   G   0.012   0.928   0.000
        8   S   0.012   0.962   0.000
        9   W   0.012   0.950   0.000
       10   L   0.011   0.971   0.005
       11   L   0.013   0.982   0.016
       12   V   0.012   0.981   0.022
       13   L   0.012   0.978   0.034
       14   F   0.014   0.966   0.046
       15   V   0.013   0.920   0.055
       16   A   0.017   0.929   0.071
       17   T   0.033   0.910   0.111
       18   W   0.042   0.920   0.138
       19   S   0.047   0.907   0.157
       20   D   0.201   0.832   0.347
       21   L   0.068   0.820   0.212
       22   G   0.136   0.799   0.312
       23   L   0.111   0.436   0.292
       24   C   0.074   0.395   0.236
       25   K   0.656   0.153   0.694
       26   K   0.075   0.129   0.224
       27   R   0.106   0.098   0.255
       28   P   0.016   0.079   0.094
       29   K   0.060   0.057   0.167
       30   P   0.013   0.049   0.071
       31   G   0.020   0.041   0.080
       32   G   0.025   0.034   0.078
       33   G   0.017   0.035   0.055
       34   W   0.050   0.044   0.072
       35   N   0.017   0.030   0.035
       36   T   0.014   0.028   0.022
       37   G   0.013   0.029   0.017
       38   G   0.011   0.029   0.012
       39   S   0.014   0.036   0.009
       40   R   0.014   0.031   0.005
       41   Y   0.017   0.030   0.000
       42   P   0.012   0.037   0.000
       43   G   0.011   0.037   0.000
                                     Signal peptide?
    C max = 0.656 at pos. 25
    S max = 0.982 at pos. 11         YES (cutoff = 0.87)
    Y max = 0.694 at pos. 25         YES (cutoff = 0.31)
    S mean (from 1 to 24) = 0.849    YES (cutoff = 0.50)
    Most likely cleavage site between pos. 24 and 25